![Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Analysis in human cell line SiHa.](http://images.novusbio.com/fullsize/OTUD7B-Cezanne-ZA20D1-Antibody-Western-Blot-NBP1-88095-img0009.jpg "Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Analysis in human cell line SiHa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PHQDSIPSLEPGSHSKDGLHRGALLPPPYRVADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OTUD7B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP1-88095 | Applications | Species |
|---|---|---|
| Cui C. P, Zhang Y, et al. Dynamic ubiquitylation of Sox2 regulates proteostasis and governs neural progenitor cell differentiation. Nat Commun 2018-11-07 [PMID: 30405104] (WB, Mouse, Human) | WB | Mouse, Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for OTUD7B/Cezanne/ZA20D1 Antibody (NBP1-88095)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OTUD7B |
![Immunocytochemistry/Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, fixed and stained with anti-OTUD7B (green). Nuclei were counterstained with HO (blue). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-07025-z) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/OTUD7B-Cezanne-ZA20D1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88095-img0011.jpg "Immunocytochemistry/Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, fixed and stained with anti-OTUD7B (green). Nuclei were counterstained with HO (blue). Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-07025-z) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/OTUD7B-Cezanne-ZA20D1-Antibody-Immunohistochemistry-Paraffin-NBP1-88095-img0010.jpg "Immunohistochemistry-Paraffin: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/OTUD7B-Cezanne-ZA20D1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88095-img0008.jpg "Immunocytochemistry/Immunofluorescence: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - Staining of human cell line U-251 MG shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.")
![Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - COP1 & OTUD7B coordinate to control NPCs differentiation. a, b NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, immunoblotting (a) & immunofluorescence (b) of Sox2, CUL4A, COP1, OTUD7B & TUJ1 were performed. c Cells transfected with HA-Ub & indicated shRNA were treated by MG132 for 8 h, & the lysates were immunoprecipated with anti-Sox2 antibody & immunoblotted with anti-HA. d Summary of our findings. OTUD7B stabilizes Sox2 through deubiquitylation & maintains the stemness of NPCs, while CUL4ADET1-COP1 promotes Sox2 degradation through ubiquitylation & induces differentiation of NPCs. OTUD7B & CUL4ADET1-COP1 exert opposite roles in regulating Sox2 protein stability at the post-translational level. The representative images are shown from three independent experiments. Unprocessed original scans of blots are shown in Supplementary Fig. 9 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30405104), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-88095_rabbit-polyclonal-otud7b-cezanne-za20d1-antibody-310202416114710.jpg "Western Blot: OTUD7B/Cezanne/ZA20D1 Antibody [NBP1-88095] - COP1 & OTUD7B coordinate to control NPCs differentiation. a, b NPCs were plated in Matrigel-coated six-well plate for neuronal differentiation. For the indicated times, immunoblotting (a) & immunofluorescence (b) of Sox2, CUL4A, COP1, OTUD7B & TUJ1 were performed. c Cells transfected with HA-Ub & indicated shRNA were treated by MG132 for 8 h, & the lysates were immunoprecipated with anti-Sox2 antibody & immunoblotted with anti-HA. d Summary of our findings. OTUD7B stabilizes Sox2 through deubiquitylation & maintains the stemness of NPCs, while CUL4ADET1-COP1 promotes Sox2 degradation through ubiquitylation & induces differentiation of NPCs. OTUD7B & CUL4ADET1-COP1 exert opposite roles in regulating Sox2 protein stability at the post-translational level. The representative images are shown from three independent experiments. Unprocessed original scans of blots are shown in Supplementary Fig. 9 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30405104), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICAM1_AF796_Immunohistochemistry_17354.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-4120241048112.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-41202410481112.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")