Osteoadherin/OSAD/OMD Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
OMD |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100 |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for Osteoadherin/OSAD/OMD Antibody
Background
OMD may be implicated in the biomineralization processes. It has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Publications for Osteoadherin/OSAD/OMD Antibody (NBP2-68892) (0)
There are no publications for Osteoadherin/OSAD/OMD Antibody (NBP2-68892).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Osteoadherin/OSAD/OMD Antibody (NBP2-68892) (0)
There are no reviews for Osteoadherin/OSAD/OMD Antibody (NBP2-68892).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Osteoadherin/OSAD/OMD Antibody (NBP2-68892) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Osteoadherin/OSAD/OMD Products
Blogs on Osteoadherin/OSAD/OMD