![Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml](http://images.novusbio.com/fullsize/ORMDL3-Antibody-Western-Blot-NBP1-98511-img0003.jpg "Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target: ORMDL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): THP1 Cell Lysate (N30). Antibody concentration: 4ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen for this antibody is ORMDL3 - N-terminal region. Peptide sequence GTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTN. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ORMDL3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 17 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL-33_AF3626_Western_Blot_11104.jpg)
![Neutralization IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL33_AF3626_Block_Neutralize_16781.jpg)
![Immunohistochemistry IL-33 Antibody [Unconjugated]](https://images.novusbio.com/images2/IL33_AF3626_ELISA_Capture_17376.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ORMDL3 Antibody (NBP1-98511)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ORMDL3 Antibody [NBP1-98511] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%](http://images.novusbio.com/fullsize/ORMDL3-Antibody-Western-Blot-NBP1-98511-img0002.jpg "Western Blot: ORMDL3 Antibody [NBP1-98511] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%")
![Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target Name: ORMDL3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/ORMDL3-Antibody-Western-Blot-NBP1-98511-img0004.jpg "Western Blot: ORMDL3 Antibody [NBP1-98511] - Host: Rabbit. Target Name: ORMDL3. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml")
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2475.jpg)
![N/A ST2/IL-33R [Biotin]](https://images.novusbio.com/images2/DATA_ST2_DY523_ELISA_2088.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Western_Blot_6125.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1Acid_Glycoprotein_MAB3694_Western_Blot_21887.jpg)
![Immunohistochemistry alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Immunohistochemistry_9988.jpg)
![Immunocytochemistry IL-18R alpha/IL-1 R5 Antibody (70625) [Unconjugated]](https://images.novusbio.com/images2/IL-18_R_alpha_MAB840_Immunocytochemistry_6629.jpg)
![Immunohistochemistry IL-18R alpha/IL-1 R5 Antibody (70625) [Unconjugated]](https://images.novusbio.com/images2/mab840_human-il-18-r-alpha-il-1-r5-mab-clone-70625-immunohistochemistry-892022134417.jpg)
![ADAM33 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ADAM33 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")