![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining in human testis and endometrium tissues using anti-ZPBP2 antibody. Corresponding ZPBP2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0008.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining in human testis and endometrium tissues using anti-ZPBP2 antibody. Corresponding ZPBP2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FIAFQVNPFAPGWKGACNGSVDCEDTTNHNILQARDRIEDFFRSQAYIFYHNFNKTLPAMHFVDHSLQVVRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYGAKSCPQT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZPBP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZPBP2 |
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human colon, liver, lymph node and testis using Anti-ZPBP2 antibody NBP1-82689 (A) shows similar protein distribution across tissues to independent antibody NBP2-33671 (B).](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0010.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human colon, liver, lymph node and testis using Anti-ZPBP2 antibody NBP1-82689 (A) shows similar protein distribution across tissues to independent antibody NBP2-33671 (B).")
![Western Blot: ZPBP2 Antibody [NBP1-82689] - Analysis in control (vector only transfected HEK293T lysate) and ZPBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Western-Blot-NBP1-82689-img0009.jpg "Western Blot: ZPBP2 Antibody [NBP1-82689] - Analysis in control (vector only transfected HEK293T lysate) and ZPBP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human lymph node.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0012.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0006.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0007.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human colon.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0011.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human liver.](http://images.novusbio.com/fullsize/ZPBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82689-img0013.jpg "Immunohistochemistry-Paraffin: ZPBP2 Antibody [NBP1-82689] - Staining of human liver.")
![Western Blot Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Western_Blot_5594.jpg)
![Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Chromatin_Immunoprecipitation_11241.jpg)
![Simple Western Ikaros/IKZF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Ikaros_AF4984_Simple_Western_16946.jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")