![Western Blot: Nucleobindin 1 Antibody [NBP1-88217] - Analysis in human cell line SiHa.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Western-Blot-NBP1-88217-img0021.jpg "Western Blot: Nucleobindin 1 Antibody [NBP1-88217] - Analysis in human cell line SiHa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGWETVEMHPAYTEEELRRFEEELAAREAELNAKAQRLSQETEALGRSQGRLEAQKRELQQAVLHMEQRKQQQQQQQGHKAPAAHPEGQLKFHPDTDDVPVPA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NUCB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUCB1 |
![Immunocytochemistry/Immunofluorescence: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88217-img0014.jpg "Immunocytochemistry/Immunofluorescence: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining in human small intestine and pancreas tissues using NBP1-88217 antibody. Corresponding NUCB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88217-img0020.jpg "Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining in human small intestine and pancreas tissues using NBP1-88217 antibody. Corresponding NUCB1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88217-img0016.jpg "Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88217-img0017.jpg "Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88217-img0018.jpg "Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human small intestine shows strong positivity in Golgi apparatus in glandular cells.](http://images.novusbio.com/fullsize/Nucleobindin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88217-img0019.jpg "Immunohistochemistry-Paraffin: Nucleobindin 1 Antibody [NBP1-88217] - Staining of human small intestine shows strong positivity in Golgi apparatus in glandular cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")