Noggin Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATS |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NOG |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Noggin Antibody
Background
Noggin is involved in numerous developmental processes, such as neural tube fusion and joint formation. The morphogenesis of organs is initiated by a downgrowth from a layer of epithelial stem cells. This process is achieved through the receipt of signals from 1) a WNT protein (WNT3A) to stabilize beta-catenin; and 2) Noggin, which is a bone morphogenetic protein inhibitor. Noggin mutations in unrelated families with proximal symphalangism (SYM1) and multiple synostoses syndrome (SYNS1) have been identified, which have multiple joint fusion as their principal defect.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: BA
Species: Mu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: Block, IHC
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC
Publications for Noggin Antibody (NBP2-34141) (0)
There are no publications for Noggin Antibody (NBP2-34141).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Noggin Antibody (NBP2-34141) (0)
There are no reviews for Noggin Antibody (NBP2-34141).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Noggin Antibody (NBP2-34141) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Noggin Products
Research Areas for Noggin Antibody (NBP2-34141)
Find related products by research area.
|
Blogs on Noggin