![Western Blot: NDUFA12 Antibody [NBP1-88935] - Analysis in human cell line NB4.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Western-Blot-NBP1-88935-img0011.jpg "Western Blot: NDUFA12 Antibody [NBP1-88935] - Analysis in human cell line NB4.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFA12 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88935 | Applications | Species |
|---|---|---|
| Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFA12 Antibody (NBP1-88935)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFA12 |
![Immunocytochemistry/Immunofluorescence: NDUFA12 Antibody [NBP1-88935] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88935-img0003.jpg "Immunocytochemistry/Immunofluorescence: NDUFA12 Antibody [NBP1-88935] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Immunohistochemistry-Paraffin-NBP1-88935-img0009.jpg "Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Immunohistochemistry-Paraffin-NBP1-88935-img0005.jpg "Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Immunohistochemistry-Paraffin-NBP1-88935-img0007.jpg "Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/NDUFA12-Antibody-Immunohistochemistry-Paraffin-NBP1-88935-img0008.jpg "Immunohistochemistry-Paraffin: NDUFA12 Antibody [NBP1-88935] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")