![Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.](http://images.novusbio.com/fullsize/Mago-nashi-homolog-2-Antibody-Western-Blot-H00055110-B01P-img0005.jpg "Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in Jurkat.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | FLJ10292 (NP_060518.1, 1 a.a. - 148 a.a.) full-length human protein. MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
| Specificity | FLJ10292 - mago-nashi homolog 2, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MAGOHB |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate for western blot and recombinant protein with GST tag for ELISA and Western Blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Mago nashi homolog 2 Antibody (H00055110-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAGOHB |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/Mago-nashi-homolog-2-Antibody-Immunocytochemistry-Immunofluorescence-H00055110-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of purified antibody to FLJ10292 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Mago-nashi-homolog-2-Antibody-Western-Blot-H00055110-B01P-img0006.jpg "Western Blot: Mago nashi homolog 2 Antibody [H00055110-B01P] - Analysis of MAGOHB expression in transfected 293T cell line by MAGOHB polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")