![Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - Human MCF7 cells was stained with primary NARF antibody (1:50), followed by Goat anti-Rabbit IgG (H+L) Secondary Antibody [Texas Red] [NB120-7088] (1:1000). Image added from verified customer review.](http://images.novusbio.com/fullsize/NARF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55660-img0005.jpg "Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - Human MCF7 cells was stained with primary NARF antibody (1:50), followed by Goat anti-Rabbit IgG (H+L) Secondary Antibody [Texas Red] [NB120-7088] (1:1000). Image added from verified customer review.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KTDDQENVSADAPSPAQENGEKGEFHKLADAKIFLSDCLACDSCMTAEEGVQLSQQNAKDFFRVLNLNKKCDTSKHKVLVVSVCPQSLPYFAAKFNLSVTDASRRLCGFLKSLG |
| Predicted Species | Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NARF |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
| Publication using NBP2-55660 | Applications | Species |
|---|---|---|
| Yang Y, Chen C, Zuo Q Et al. NARF is a hypoxia-induced coactivator for OCT4-mediated breast cancer stem cell specification Sci Adv 2022-12-09 [PMID: 36490339] (ICC/IF, WB, IP, Human) | ICC/IF, WB, IP | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Yongkang Yang |
IF | Human | 03/17/2021 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Yongkang Yang |
WB | Human | 08/16/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Yongkang Yang 03/17/2021 |
||
| Application: | IF | |
| Species: | Human |
| Yongkang Yang 08/16/2019 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | NARF |
![Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - ICC/IF of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is in green.](http://images.novusbio.com/fullsize/NARF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55660-img0001.jpg "Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - ICC/IF of human cell line MCF7 shows localization to nucleus & nucleoli. Antibody staining is in green.")
![Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - SUM-159PT human breast cancer cell line. Antibody was used at 1:50 for labeling and microscopy analysis of the distribution of NARF proteins in SUM-159PT breast cancer cells. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/NARF-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55660-img0004.jpg "Immunocytochemistry/Immunofluorescence: NARF Antibody [NBP2-55660] - SUM-159PT human breast cancer cell line. Antibody was used at 1:50 for labeling and microscopy analysis of the distribution of NARF proteins in SUM-159PT breast cancer cells. ICC/IF image submitted by a verified customer review.")
![Knockdown Validated: NARF Antibody [NBP2-55660] - Cell lysate from MCF7 cells grown in DMEM medium. 30 ug cell lysate per lane. 10% SDS-PAGE. NARF antibody at 1:1000 dilution. HRP-conjugated secondary donkey anti-rabbit IgG polyclonal antibody at 1:2000 dilution. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/NARF-Antibody-Western-Blot-NBP2-55660-img0003.jpg "Knockdown Validated: NARF Antibody [NBP2-55660] - Cell lysate from MCF7 cells grown in DMEM medium. 30 ug cell lysate per lane. 10% SDS-PAGE. NARF antibody at 1:1000 dilution. HRP-conjugated secondary donkey anti-rabbit IgG polyclonal antibody at 1:2000 dilution. WB image submitted by a verified customer review.")
![Western Blot: NARF Antibody [NBP2-55660] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/antibody/nbp2-55660_rabbit-polyclonal-narf-antibody-western-blot-231202411130..jpg "Western Blot: NARF Antibody [NBP2-55660] - Analysis in human cell line MOLT-4.")
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
