Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022). AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | CDH2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for N-Cadherin Antibody (NBP3-15654)Find related products by research area.
|
Read full blog post. |
Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric ... Read full blog post. |
Beta Tubulin III and neurogenesis Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr... Read full blog post. |
Epithelial-Mesenchymal Transition (EMT) Markers Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a... Read full blog post. |
CD63: is it pro-metastatic or anti-metastatic? CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,... Read full blog post. |
MMP24 (Matrix metalloproteinase-24, matrix metalloproteinase-25, MT5-MMP) MMP24 is an extracellular matrix (ECM) degradative peptidase enzyme that is a member of the large family of matrix metalloproteinases (MMP). Each MMP has a different substrate specificity, and the aberrant or derailed expression of these is strongly c... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CDH2 |