Home » Musashi-1 » Musashi-1 Antibodies » Musashi-1 Antibody
Novus Biologicals products are now on bio-techne.com

Musashi-1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Staining of human retina shows strong nuclear and cytoplasmic positivity in inner nuclear and ganglion cell layers.
Staining of human retina shows strong nuclear and cytoplasmic positivity in inner nuclear and ganglion cell layers.
Staining of human cell line SH-SY5Y shows localization to nucleoplasm & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Musashi-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMA
Predicted Species
Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSI1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Musashi-1 Antibody

  • MSI1
  • Musashi (Drosophila) homolog 1
  • musashi homolog 1 (Drosophila)
  • Musashi1
  • Musashi-1
  • RNA-binding protein Musashi homolog 1

Background

Musashi1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells. Musashi-1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia. It may play a role in the pathogenesis of various neurodegenerative disorders. Musashi1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development. Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
CD133 Antibody -
BSA Free
NB120-16518
Immunohistochemistry-Paraffin CD133 Antibody - BSA Free
Western Blot CD133 Antibody - BSA Free
Chromatin Immunoprecipitation CD133 Antibody - BSA Free
(42 Publications)
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Musashi-2 Antibody
- BSA Free
NBP2-52978
Immunocytochemistry/ Immunofluorescence Musashi-2 Antibody - BSA Free
Immunohistochemistry-Paraffin Musashi-2 Antibody - BSA Free
Western Blot Musashi-2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Lgr5/GPR49
Antibody - BSA Free
NBP1-28904
Immunohistochemistry Lgr5/GPR49 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Lgr5/GPR49 Antibody - BSA Free
Immunohistochemistry Lgr5/GPR49 Antibody - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(843 Publications)
Species: Hu
Applications: BA
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
ABCG2/CD338
Antibody (3G8) - BSA
NBP2-22124
ELISA ABCG2/CD338 Antibody (3G8) - BSA Free
Flow Cytometry ABCG2/CD338 Antibody (3G8) - BSA Free
Immunocytochemistry/ Immunofluorescence ABCG2/CD338 Antibody (3G8) - BSA Free
(8 Publications)
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Musashi-1 Antibody
NBP3-21216
Musashi-1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for Musashi-1 Antibody (NBP3-21216) (0)

There are no publications for Musashi-1 Antibody (NBP3-21216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Musashi-1 Antibody (NBP3-21216) (0)

There are no reviews for Musashi-1 Antibody (NBP3-21216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Musashi-1 Antibody (NBP3-21216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Musashi-1 Products

Research Areas for Musashi-1 Antibody (NBP3-21216)

Find related products by research area.

Blogs on Musashi-1

There are no specific blogs for Musashi-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Musashi-1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MSI1