![Western Blot: EAF1 Antibody [H00085403-B01P] - Analysis of EAF1 expression in transfected 293T cell line by EAF1 polyclonal antibody. Lane 1: EAF1 transfected lysate(29.48 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/EAF1-Antibody-Western-Blot-H00085403-B01P-img0006.jpg "Western Blot: EAF1 Antibody [H00085403-B01P] - Analysis of EAF1 expression in transfected 293T cell line by EAF1 polyclonal antibody. Lane 1: EAF1 transfected lysate(29.48 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | EAF1 (AAH41329.1, 1 a.a. - 268 a.a.) full-length human protein. MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD |
| Specificity | EAF1 - ELL associated factor 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | EAF1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence, immunohistochemistry (paraffin). |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for EAF1 Antibody (H00085403-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EAF1 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/EAF1-Antibody-Immunocytochemistry-Immunofluorescence-H00085403-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on formalin-fixed paraffin-embedded human stomach. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/EAF1-Antibody-Immunohistochemistry-Paraffin-H00085403-B01P-img0005.jpg "Immunohistochemistry-Paraffin: EAF1 Antibody [H00085403-B01P] - Analysis of purified antibody to EAF1 on formalin-fixed paraffin-embedded human stomach. (antibody concentration 3 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")