![Western Blot: MPG Antibody (1G6) [H00004350-M10] - Analysis of MPG expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/MPG-Antibody-1G6-Western-Blot-H00004350-M10-img0007.jpg "Western Blot: MPG Antibody (1G6) [H00004350-M10] - Analysis of MPG expression in Hela S3 NE (Cat # L013V3).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 1G6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
| Specificity | MPG (1G6) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MPG |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for MPG Antibody (H00004350-M10)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: MPG Antibody (1G6) [H00004350-M10] - Analysis of monoclonal antibody to MPG on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/MPG-Antibody-1G6-Immunocytochemistry-Immunofluorescence-H00004350-M10-img0005.jpg "Immunocytochemistry/Immunofluorescence: MPG Antibody (1G6) [H00004350-M10] - Analysis of monoclonal antibody to MPG on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry-Paraffin: MPG Antibody (1G6) [H00004350-M10] - Analysis of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 1 ug/ml](http://images.novusbio.com/fullsize/MPG-Antibody-1G6-Immunohistochemistry-Paraffin-H00004350-M10-img0006.jpg "Immunohistochemistry-Paraffin: MPG Antibody (1G6) [H00004350-M10] - Analysis of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 1 ug/ml")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
