![Western Blot: MMAB Antibody [H00326625-B02P] - Analysis of MMAB expression in transfected 293T cell line by MMAB polyclonal antibody. Lane 1: MMAB transfected lysate(27.5 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MMAB-Antibody-Western-Blot-H00326625-B02P-img0002.jpg "Western Blot: MMAB Antibody [H00326625-B02P] - Analysis of MMAB expression in transfected 293T cell line by MMAB polyclonal antibody. Lane 1: MMAB transfected lysate(27.5 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MMAB (NP_443077.1, 1 a.a. - 250 a.a.) full-length human protein. MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL |
| Specificity | This product is specific for Human MMAB purified MaxPab mouse polyclonal antibody (B02P) [Gene ID: 326625]. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MMAB |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse polyclonal antibody raised against a full-length human MMAB protein. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0001.jpg)
![Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Immunohistochemistry-Paraffin-NBP2-24457-img0003.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0005.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MMAB |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: MMAB Antibody [H00326625-B02P] - Analysis of purified antibody to MMAB on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/MMAB-Antibody-Immunocytochemistry-Immunofluorescence-H00326625-B02P-img0001.jpg "Immunocytochemistry/Immunofluorescence: MMAB Antibody [H00326625-B02P] - Analysis of purified antibody to MMAB on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")