![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human colon, kidney, liver and lymph node using Anti-MDH2 antibody NBP1-89540 (A) shows similar protein distribution across tissues to independent antibody NBP1-86036 (B).](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0015.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human colon, kidney, liver and lymph node using Anti-MDH2 antibody NBP1-89540 (A) shows similar protein distribution across tissues to independent antibody NBP1-86036 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MDH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MDH2 |
![Western Blot: MDH2 Antibody [NBP1-89540] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/MDH2-Antibody-Western-Blot-NBP1-89540-img0020.jpg "Western Blot: MDH2 Antibody [NBP1-89540] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-89540] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining shown in green.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89540-img0010.jpg "Immunocytochemistry/Immunofluorescence: MDH2 Antibody [NBP1-89540] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining shown in green.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0024.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: MDH2 Antibody [NBP1-89540] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/MDH2-Antibody-Western-Blot-NBP1-89540-img0009.jpg "Western Blot: MDH2 Antibody [NBP1-89540] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human colon.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0017.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human colon.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human lymph node.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0018.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human kidney.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0019.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human pancreas shows moderate to strong granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0021.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human pancreas shows moderate to strong granular cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human skeletal muscle shows moderate to strong granular cytoplasmic positivity in myocytes](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0022.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human skeletal muscle shows moderate to strong granular cytoplasmic positivity in myocytes")
![Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/MDH2-Antibody-Immunohistochemistry-Paraffin-NBP1-89540-img0023.jpg "Immunohistochemistry-Paraffin: MDH2 Antibody [NBP1-89540] - Staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.")
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")