![Western Blot: MBNL3 Antibody [H00055796-B01P] - Analysis of MBNL3 expression in human placenta.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Western-Blot-H00055796-B01P-img0001.jpg "Western Blot: MBNL3 Antibody [H00055796-B01P] - Analysis of MBNL3 expression in human placenta.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MBNL3 (AAH42090.1, 1 a.a. - 258 a.a.) full-length human protein. MFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | MBNL3 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MBNL3 |
| Uniprot |
|
![Western Blot: MBNL3 Antibody [H00055796-B01P] - Analysis of MBNL3 expression in transfected 293T cell line by MBNL3 polyclonal antibody. Lane 1: MBNL3 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MBNL3-Antibody-Western-Blot-H00055796-B01P-img0002.jpg "Western Blot: MBNL3 Antibody [H00055796-B01P] - Analysis of MBNL3 expression in transfected 293T cell line by MBNL3 polyclonal antibody. Lane 1: MBNL3 transfected lysate(28.38 KDa). Lane 2: Non-transfected lysate.")
![Immunocytochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunocytochemistry_15884.jpg)
![Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunohistochemistry_17796.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")