![Immunocytochemistry/Immunofluorescence: LRRC16A Antibody [NBP1-91222] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91222-img0006.jpg "Immunocytochemistry/Immunofluorescence: LRRC16A Antibody [NBP1-91222] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CARMIL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CARMIL1 |
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human lymph node.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0013.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0007.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0008.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining in human testis and liver tissues using anti-CARMIL1 antibody. Corresponding CARMIL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0009.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining in human testis and liver tissues using anti-CARMIL1 antibody. Corresponding CARMIL1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon, kidney, lymph node and testis using Anti-CARMIL1 antibody NBP1-91222 (A) shows similar protein distribution across tissues to independent antibody NBP1-91221 (B).](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0010.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon, kidney, lymph node and testis using Anti-CARMIL1 antibody NBP1-91222 (A) shows similar protein distribution across tissues to independent antibody NBP1-91221 (B).")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human kidney.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0011.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon.](http://images.novusbio.com/fullsize/LRRC16A-Antibody-Immunohistochemistry-Paraffin-NBP1-91222-img0012.jpg "Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")