![Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-2B5-Western-Blot-H00116085-M02-img0002.jpg "Western Blot: SLC22A12 Antibody (2B5) [H00116085-M02] - SLC22A12 monoclonal antibody (M02), clone 2B5. Analysis of SLC22A12 expression in human stomach.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2B5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR |
| Specificity | SLC22A12 - solute carrier family 22 (organic anion/cation transporter), member 12 (2B5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC22A12 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SLC22A12-Antibody-2B5-ELISA-H00116085-M02-img0003.jpg "ELISA: SLC22A12 Antibody (2B5) [H00116085-M02] - Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.")
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
