![Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining in human lymph node and skeletal muscle tissues using anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-85614-img0010.jpg "Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining in human lymph node and skeletal muscle tissues using anti-SH3KBP1 antibody. Corresponding SH3KBP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDY |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SH3KBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SH3KBP1 |
![Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis using Anti-SH3KBP1 antibody NBP1-85614 (A) shows similar pattern to independent antibody NBP1-85615 (B).](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Western-Blot-NBP1-85614-img0011.jpg "Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis using Anti-SH3KBP1 antibody NBP1-85614 (A) shows similar pattern to independent antibody NBP1-85615 (B).")
![Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in human cell line THP-1.](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Western-Blot-NBP1-85614-img0007.jpg "Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in human cell line THP-1.")
![Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Western-Blot-NBP1-85614-img0008.jpg "Western Blot: CIN85/SH3KBP1 Antibody [NBP1-85614] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human lymph node shows strong cytoplasmic positivity.](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-85614-img0005.jpg "Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human lymph node shows strong cytoplasmic positivity.")
![Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/CIN85-SH3KBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-85614-img0009.jpg "Immunohistochemistry-Paraffin: CIN85/SH3KBP1 Antibody [NBP1-85614] - Staining of human skeletal muscle shows low expression as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP-2_AF8171_Western_Blot_5906.jpg)
![Simple Western cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP2_AF8171_Simple_Western_16646.jpg)
![Immunohistochemistry cIAP-2/HIAP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/cIAP-2_AF8171_Immunohistochemistry_6903.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")