LRPPRC Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVT |
| Predicted Species |
Mouse (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
LRPPRC |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Knockdown Validated
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for LRPPRC Antibody - BSA Free
Background
The LRPPRC gene encodes a protein that is leucine-rich and is thought to play a role in regulating the interaction of the cytoskeleton with a variety of cellular processes. Mutations in this gene are associated with the French-Canadian type of Leigh syndrome. T
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, KD
Publications for LRPPRC Antibody (NBP1-83349)(1)
Showing Publication 1 -
1 of 1.
Reviews for LRPPRC Antibody (NBP1-83349) (0)
There are no reviews for LRPPRC Antibody (NBP1-83349).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LRPPRC Antibody (NBP1-83349) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LRPPRC Products
Research Areas for LRPPRC Antibody (NBP1-83349)
Find related products by research area.
|
Blogs on LRPPRC
![Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human cerebellum, colon, kidney and liver using Anti-LRPPRC antibody NBP1-83349 (A) shows similar protein distribution across tissues to independent antibody NBP2-38300 (B).](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunohistochemistry-Paraffin-NBP1-83349-img0009.jpg "Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human cerebellum, colon, kidney and liver using Anti-LRPPRC antibody NBP1-83349 (A) shows similar protein distribution across tissues to independent antibody NBP2-38300 (B).")
![Western Blot: LRPPRC Antibody [NBP1-83349] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LRPPRC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Western-Blot-NBP1-83349-img0008.jpg "Western Blot: LRPPRC Antibody [NBP1-83349] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LRPPRC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: LRPPRC Antibody [NBP1-83349] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83349-img0007.jpg "Immunocytochemistry/Immunofluorescence: LRPPRC Antibody [NBP1-83349] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human colon.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunohistochemistry-Paraffin-NBP1-83349-img0012.jpg "Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human colon.")
![Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human kidney.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunohistochemistry-Paraffin-NBP1-83349-img0010.jpg "Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human liver.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunohistochemistry-Paraffin-NBP1-83349-img0011.jpg "Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human liver.")
![Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human cerebellum.](http://images.novusbio.com/fullsize/LRPPRC-Antibody-Immunohistochemistry-Paraffin-NBP1-83349-img0013.jpg "Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human cerebellum.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![LIF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LIF [Unconjugated]")
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Simple_Western_21000.jpg)
![Western Blot STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Western_Blot_5993.jpg)
![Knockout Validated STAT3 Antibody (232209) [Unconjugated]](https://images.novusbio.com/images2/STAT3_MAB1799_Knockout_Validated_21531.jpg)
![N/A gp130/CD130 [HRP]](https://images.novusbio.com/images2/DATA_gp130_DGP00_ELISA_705.jpg)
![N/A gp130/CD130 [HRP]](https://images.novusbio.com/images2/DATA_gp130_DGP00_ELISA_706.jpg)
![N/A gp130/CD130 [HRP]](https://images.novusbio.com/images2/gp130_DGP00_ELISA_111.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![SDS-PAGE CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_502.jpg)
![Bioactivity CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_520.jpg)
![Neutralization LIFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/LIF_R_alpha_AF-249-NA_Block_Neutralize_8665.jpg)
![N/A IL-11 [HRP]](https://images.novusbio.com/images2/DATA_IL11_D1100_ELISA_529.jpg)
![N/A IL-11 [HRP]](https://images.novusbio.com/images2/DATA_IL11_D1100_ELISA_530.jpg)
![N/A IL-11 [HRP]](https://images.novusbio.com/images2/IL-11_D1100_ELISA_10.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Western_Blot_6164.jpg)
![Immunohistochemistry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Immunohistochemistry_7021.jpg)
![Intracellular Staining by Flow Cytometry Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Flow_Cytometry_8448.jpg)
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
![N/A IL-6R alpha [HRP]](https://images.novusbio.com/images2/DATA_IL6_R_alpha_DR600_ELISA_801.jpg)
![N/A IL-6R alpha [HRP]](https://images.novusbio.com/images2/IL-6_R_alpha_DR600_ELISA_168.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")