LMX1b Antibody - BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LMX1B (NP_001167618.1). MDIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFLMRVNESSWHEECLQCAACQQALTTSCYFRDRK |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
LMX1B |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for LMX1b Antibody - BSA Free
Background
LMX1B is a gene that codes for a protein with three isoforms, measuring 402, 395, and 406 amino acids in length with weights of approximately 45, 44, and 45 kDa respectively. LMX1B is necessary for the specification of dorsal limb fate. Current studies are being done on several diseases and disorders related to this gene including Meier-Gorlin syndrome, steroid-resistant nephrotic syndrome, sex reversal, attention deficit hyperactivity disorder, cleft lip/palate, familial Mediterranean fever, genitopatellar syndrome, major depressive disorder, nail dysplasia, short stature, heart block, and neuronitis. LMX1B has also been shown to have interactions with LDB1, TCF3, SSBP3, ALX4, and LDB2 in pathways such as the SIDS susceptibility pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC-P
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Publications for LMX1b Antibody (NBP3-03914) (0)
There are no publications for LMX1b Antibody (NBP3-03914).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for LMX1b Antibody (NBP3-03914) (0)
There are no reviews for LMX1b Antibody (NBP3-03914).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for LMX1b Antibody (NBP3-03914) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional LMX1b Products
Research Areas for LMX1b Antibody (NBP3-03914)
Find related products by research area.
|
Blogs on LMX1b