Home » LANCL1 » LANCL1 Proteins » LANCL1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LANCL1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LANCL1 Protein (NBP1-81796PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LANCL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LANCL1.

Source: E. coli

Amino Acid Sequence: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LANCL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81796.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LANCL1 Recombinant Protein Antigen

  • 40 kDa erythrocyte membrane protein
  • LanC (bacterial lantibiotic synthetase component C)-like 1
  • LanC (bacterial lantibiotic synthetase component)
  • LanC lantibiotic synthetase component C-like 1 (bacterial)
  • lanC-like protein 1
  • p40GPR69AG protein-coupled receptor 69A

Background

The LANCL1 gene encodes a peripheral membrane protien related to the LanC family protiens that are invoved in the biosynthesis of antimicrobial peptides. Previously, this protein was thought to be a part of the G-protien-coupled receptor superfamily, but it has been found that it is indeed in the LanC family. The protien might play a role as a peptide-modifying enzyme in eukaryotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-23A/IL-23 P19
[Unconjugated]
1290-IL
IL-23A/IL-23 P19 [Unconjugated]
(115 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-12
[Unconjugated]
419-ML
SDS-PAGE IL-12 [Unconjugated]
Bioactivity IL-12 [Unconjugated]
(271 Publications)
Species: Mu
Applications: BA
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CDCA5 Antibody
NBP1-89530
Western Blot CDCA5 Antibody
Immunohistochemistry-Paraffin CDCA5 Antibody
Immunocytochemistry/ Immunofluorescence CDCA5 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A1
Antibody [Unconjugate
AF3770
Western Blot Annexin A1 Antibody [Unconjugated]
Immunohistochemistry Annexin A1 Antibody [Unconjugated]
Simple Western Annexin A1 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Ficolin-2
[Unconjugated]
2428-FC
Ficolin-2 [Unconjugated]
(2 Publications)
Species: Hu
Applications: Bind
Uroplakin IIIB
Antibody
NBP1-92564
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
Immunohistochemistry-Paraffin Uroplakin IIIB Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GCHFR Antibody
(846011) [Unconjugate
MAB7918
Simple Western GCHFR Antibody (846011) [Unconjugated]
Western Blot GCHFR Antibody (846011) [Unconjugated]
Species: Hu
Applications: Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
IL-37/IL-1F7
[Biotin]
DY1975
N/A IL-37/IL-1F7 [Biotin]
(13 Publications)
Species: Hu
Applications: ELISA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Annexin A6 Antibody
NBP1-90149
Western Blot Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
Immunohistochemistry-Paraffin Annexin A6 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
p19 INK4d Antibody
(DCS-100)
NBP3-11884
Immunocytochemistry/ Immunofluorescence p19 INK4d Antibody (DCS-100)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody
Immunohistochemistry-Paraffin Factor IX Antibody
Immunocytochemistry/ Immunofluorescence Factor IX Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB

Publications for LANCL1 Protein (NBP1-81796PEP) (0)

There are no publications for LANCL1 Protein (NBP1-81796PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LANCL1 Protein (NBP1-81796PEP) (0)

There are no reviews for LANCL1 Protein (NBP1-81796PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LANCL1 Protein (NBP1-81796PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LANCL1 Products

Research Areas for LANCL1 Protein (NBP1-81796PEP)

Find related products by research area.

Blogs on LANCL1

There are no specific blogs for LANCL1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LANCL1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LANCL1