Novus Biologicals products are now on bio-techne.com

Lamin B2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Lamin B2 Antibody [NBP2-49368] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Lamin B2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMNB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Lamin B2 Recombinant Protein Antigen (NBP2-49368PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lamin B2 Antibody

  • lamin B2
  • lamin-B2
  • LMN2LAMB2
  • MGC2721

Background

An important part of the cell nucleus is formed by nuclear lamina. Nuclear lamins form a network of filaments at the nucleoplasmic site of the nuclear membrane. Two main subtypes of nuclear lamins can be distinguished, i.e. A-type lamins and B-type lamins. The A-type lamins comprise a set of three proteins arising from the same gene by alternative splicing, i.e. Lamin A, Lamin C and lamin Adel10, while the B-type lamins include two proteins arising from two distinct genes, i.e. Lamin B1 and Lamin B2. The nuclear lamins comprise a unique subclass of the intermediate filament protein family. They share a molecular domain organisation with the other intermediate filament proteins in that they are fibrous molecules that have an aminoterminal globular head, a central rod of a-helices and a carboxyterminal globular domain. Many biochemical and molecular features of lamins have been studied, but their functions remain still largely undetermined. One of the functions ascribed to the lamina is the maintenance of the structural integrity of the nucleus. Besides interactions with the nuclear membrane and other intermediate filaments, lamins interact with the nuclear chromatin. Eukaryotic chromatin is organized into loops, which are attached to the nuclear matrix. This organization is thought to contribute to compaction of the chromatin and regulation of gene expression. Lamins, as part of the nuclear matrix, may be involved in these processes since chromatin binding sites have been detected in both A- and B-type lamins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59783
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
AF3159
Species: Mu
Applications: IHC
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
H00003930-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87822
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-2388
Species: Hu
Applications: WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49368
Species: Hu
Applications: ICC/IF

Publications for Lamin B2 Antibody (NBP2-49368) (0)

There are no publications for Lamin B2 Antibody (NBP2-49368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lamin B2 Antibody (NBP2-49368) (0)

There are no reviews for Lamin B2 Antibody (NBP2-49368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Lamin B2 Antibody (NBP2-49368). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for human lamin antibodies that might cross react with Drosophila lamins. I've found a few that I'm interested in, one of which comes in a smaller sample size. The other two do not have a smaller size ordering option. I was wondering if it would be possible to get these other antibodies in a smaller size as well, so we can test reactivity with Drosophila lamins before ordering the full-sized product?
    • We have a wide range of antibodies to human Lamin. Unfortunately none of these has yet been tested against Drosophila samples, however you may be interested in our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. We are unable to offer free samples of our antibodies but, as you rightly point out, some are available as smaller, sample size aliquots. If a sample size is not listed for a product I am afraid we are unable to offer a smaller aliquot than those already listed.

Secondary Antibodies

 

Isotype Controls

Additional Lamin B2 Products

Research Areas for Lamin B2 Antibody (NBP2-49368)

Find related products by research area.

Blogs on Lamin B2

There are no specific blogs for Lamin B2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lamin B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMNB2