Western Blot: Lactate Dehydrogenase B Antibody [NBP2-38131] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: Lactate Dehydrogenase B Antibody [NBP2-38131] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Lactate Dehydrogenase B Antibody [NBP2-38131] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
This antibody was developed against a recombinant protein corresponding to amino acids: HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LDHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in ELISA reported in scientific literature (PMID:35052722).For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100..
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for Lactate Dehydrogenase B Antibody
EC 1.1.1
EC 1.1.1.27
Epididymis Secretory Protein Li 281
HEL-S-281
Lactate Dehydrogenase B
LDH heart subunit
LDHB
LDH-B
LDHBD
LDH-H
L-lactate dehydrogenase B chain
Renal Carcinoma Antigen NY-REN-46
TRG-5
Background
Lactate dehydrogenase (LDH) is an ubiquitous enzyme commonly found in wide variety of organisms, including plants and microbes. LDH is involved in the interconversion of the pyruvate and NADH to lactate and NAD+. It is also called Hydroxybutyrate Dehydrogenase (HBD), because it can catalyze the oxidation of hydroxybutyrate (1). In mammals, three types of LDH subunits (35 kDa) are encoded by the genes Ldh-A, Ldh-B, and Ldh-C. All LDH subunits can combine to form various terameric isoenzymes (140 kDa). Lactate dehydrogenase B (LDH-B, heart subunit, LDH-H) is involved in the conversion of L-lactate and NAD to pryruvate and NADH and it is predominantly localized in the heart tissue. Similar to other LDH subunit, LDH-B is considered to be an important marker for germ cell tumor (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Lactate Dehydrogenase B Antibody (NBP2-38131) (0)
There are no reviews for Lactate Dehydrogenase B Antibody (NBP2-38131).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Lactate Dehydrogenase B Antibody and receive a gift card or discount.