Home » KIF20A » KIF20A Antibodies » KIF20A Antibody
Novus Biologicals products are now on bio-techne.com

KIF20A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: KIF20A Antibody [NBP2-87689] - KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml. KIF20A is supported by BioGPS gene expression data to be expressed in 721_B
Western Blot: KIF20A Antibody [NBP2-87689] - KIF20A antibody - middle region validated by WB using 721_B Cell Lysate at 1ug/ml. KIF20A is supported by BioGPS gene expression data to be expressed in 721_B
Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF20A antibody
Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue
Immunohistochemistry: KIF20A Antibody [NBP2-87689] - Immunohistochemistry with HeLa, Vera, HeLa transfected with mouse construct tissue

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KIF20A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIF20A. Peptide sequence: KRLGTNQENQQPNQQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KIF20A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for KIF20A Antibody

  • FLJ21151
  • GG10_2
  • kinesin family member 20A
  • kinesin-like protein KIF20A
  • mitotic kinesin-like protein 2
  • MKLP2
  • Rab6-interacting kinesin-like protein
  • RAB6KIFLkinesin-like (rabkinesin6)
  • rabkinesin-6

Background

KIF20A is a member of the kinesin-like protein family and has 1 kinesin motor domain. It interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B and may act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. KIF20A has a microtubule plus end-directed motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
MKLP1 Antibody
NBP2-56923
Immunocytochemistry/ Immunofluorescence MKLP1 Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF
RAB6A Antibody
NBP1-33110
Immunocytochemistry/ Immunofluorescence RAB6A Antibody
Knockout Validated RAB6A Antibody
Western Blot RAB6A Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/ Immunofluorescence Aurora B Antibody - BSA Free
Western Blot Aurora B Antibody - BSA Free
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
MAD2L1 Antibody
NB100-563
Immunohistochemistry MAD2L1 Antibody
Immunoprecipitation MAD2L1 Antibody
(1 Review)
(14 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
HIV-1 Rev binding
protein Antibody
NBP1-91991
Immunocytochemistry/ Immunofluorescence HIV-1 Rev binding protein Antibody
Western Blot HIV-1 Rev binding protein Antibody
Immunohistochemistry-Paraffin HIV-1 Rev binding protein Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KIF15 Antibody
NBP3-17874
Western Blot KIF15 Antibody
Immunohistochemistry-Paraffin KIF15 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Eg5 Antibody
NB500-181
Western Blot Eg5 Antibody
Immunocytochemistry/ Immunofluorescence Eg5 Antibody
Western Blot Eg5 Antibody
(2 Reviews)
(21 Publications)
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
INCENP Antibody
(3D2) - BSA Free
NBP2-37471
ELISA INCENP Antibody (3D2) - BSA Free
Western Blot INCENP Antibody (3D2) - BSA Free
Western Blot INCENP Antibody (3D2) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
KIF1B Antibody
NB100-57493
Western Blot KIF1B Antibody
(3 Publications)
Species: Hu, Mu
Applications: IP, WB
Aurora B Antibody
- BSA Free
NB100-294
Immunocytochemistry/ Immunofluorescence Aurora B Antibody - BSA Free
Western Blot Aurora B Antibody - BSA Free
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
APOL3 Antibody
NBP1-06979
Western Blot APOL3 Antibody
(1 Publication)
Species: Hu
Applications: PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Mxi1 Antibody
[Unconjugated]
AF4185
Immunocytochemistry Mxi1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC
Apolipoprotein L1
Antibody
NBP1-89033
Immunohistochemistry-Paraffin Apolipoprotein L1 Antibody
Immunohistochemistry-Paraffin Apolipoprotein L1 Antibody
Western Blot Apolipoprotein L1 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Citron Kinase
Antibody
NBP1-88050
Immunohistochemistry-Paraffin Citron Kinase Antibody
Immunohistochemistry-Paraffin Citron Kinase Antibody
Immunohistochemistry-Paraffin Citron Kinase Antibody
Species: Hu
Applications: IHC, IHC-P
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(374 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(374 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
KIF20A Antibody
NBP2-87689
KIF20A Antibody
Species: Hu
Applications: WB, IHC

Publications for KIF20A Antibody (NBP2-87689) (0)

There are no publications for KIF20A Antibody (NBP2-87689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF20A Antibody (NBP2-87689) (0)

There are no reviews for KIF20A Antibody (NBP2-87689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for KIF20A Antibody (NBP2-87689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KIF20A Products

Research Areas for KIF20A Antibody (NBP2-87689)

Find related products by research area.

Blogs on KIF20A

There are no specific blogs for KIF20A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KIF20A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol KIF20A