IP3R1 Antibody Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1812-1911 of human IP3R1 (NP_001365381).
Sequence: SFFCRLTEDKKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEVRDQLLEASAATRKAFTTFRREADPDDHYQP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ITPR1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunoprecipitation 1:50 - 1:200
- Western Blot 1:1000 - 1:5000
|
Theoretical MW |
314 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for IP3R1 Antibody
Background
IP3R1 (inositol 1,4,5-triphosphate receptor type 1) is an intracellular calcium release channel that mediates calcium release from the endoplasmic reticulum. There are 3 mammalian InsP3R receptors: Insp3R1, Insp3R2, and Insp3R3. Defects in the gene which encodes InsP3R1, ITPR1, are the cause of spinocerebellar ataxia type 15 (SCA15).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P
Species: Am, Bv, Ca, Ma, Fi, Hu, Ma-Mn, Mu, Pm, Rb, Rt, Sh
Applications: B/N, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Publications for IP3R1 Antibody (NBP3-37937) (0)
There are no publications for IP3R1 Antibody (NBP3-37937).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IP3R1 Antibody (NBP3-37937) (0)
There are no reviews for IP3R1 Antibody (NBP3-37937).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IP3R1 Antibody (NBP3-37937) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IP3R1 Products
Research Areas for IP3R1 Antibody (NBP3-37937)
Find related products by research area.
|
Blogs on IP3R1