Novus Biologicals products are now on bio-techne.com

IL-13R alpha 2 Recombinant Protein Antigen

Images

 
There are currently no images for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IL-13R alpha 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-13R alpha 2

Source: E.coli

Amino Acid Sequence: YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL13RA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21272. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-13R alpha 2 Recombinant Protein Antigen

  • cancer/testis antigen 19
  • CD213a2 antigen
  • CD213a2
  • CT19
  • IL-13 R alpha 2
  • IL-13 receptor subunit alpha-2
  • IL13BP
  • IL13R alpha 2
  • IL-13R subunit alpha-2
  • IL13R
  • IL-13R
  • IL13RA2
  • IL-13Ra2
  • IL-13R-alpha-2
  • interleukin 13 binding protein
  • interleukin 13 receptor alpha 2 chain
  • interleukin 13 receptor, alpha 2
  • interleukin-13 receptor subunit alpha-2
  • Interleukin-13-binding protein

Background

IL13 receptor alpha 2 is encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY413
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
AF152
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP2-25241
Species: Hu, Mu
Applications: ICC/IF, IP, WB
230-4RB
Species: Hu
Applications: BA
MAB4260
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
202-IL
Species: Hu
Applications: BA
7268-CT
Species: Hu
Applications: BA
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF284
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
7754-BH/CF
Species: Hu
Applications: BA
NBP3-21272PEP
Species: Hu
Applications: AC

Publications for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP) (0)

There are no publications for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP) (0)

There are no reviews for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-13R alpha 2 Products

Research Areas for IL-13R alpha 2 Recombinant Protein Antigen (NBP3-21272PEP)

Find related products by research area.

Blogs on IL-13R alpha 2

There are no specific blogs for IL-13R alpha 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-13R alpha 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IL13RA2