![Western Blot: IFN-alpha F/IFNA21 Antibody [H00003452-B01P] - Analysis of IFNA21 expression in transfected 293T cell line by IFNA21 polyclonal antibody. Lane 1: IFNA21 transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/IFN-alpha-F-IFNA21-Antibody-Western-Blot-H00003452-B01P-img0002.jpg "Western Blot: IFN-alpha F/IFNA21 Antibody [H00003452-B01P] - Analysis of IFNA21 expression in transfected 293T cell line by IFNA21 polyclonal antibody. Lane 1: IFNA21 transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IFNA21 (AAH69329.1, 1 a.a. - 189 a.a.) full-length human protein. MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE |
| Specificity | IFNA21 - interferon, alpha 21, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | IFNA21 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for IFN-alpha F/IFNA21 Antibody (H00003452-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFNA21 |
| Entrez |
|
| Uniprot |
|
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Neutralization IFN-alpha/beta R2 Antibody [Unconjugated]](https://images.novusbio.com/images2/IFN-alpha_beta_R2_AF1083_Block_Neutralize_226.jpg)
![Flow Cytometry IFN-alpha/beta R2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1083_mouse-ifn-alpha-beta-r2-affinity-purified-polyclonal-ab-flow-cytometry-1762024113756..jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")