![Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Analysis in human testis and endometrium tissues. Corresponding HspA1L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HspA1L-Antibody-Immunohistochemistry-Paraffin-NBP1-92012-img0012.jpg "Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Analysis in human testis and endometrium tissues. Corresponding HspA1L RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLYQGGCTGPACGTGYVPGRPATGPTIEEVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HSPA1L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-92012 | Applications | Species |
|---|---|---|
| Yoon YM, Kim HJ, Lee JH, Lee SH Melatonin Enhances Mitophagy by Upregulating Expression of Heat Shock 70 kDa Protein 1L in Human Mesenchymal Stem Cells under Oxidative Stress Int J Mol Sci 2019-09-13 [PMID: 31540288] (IP, WB, Human) | IP, WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for HspA1L Antibody (NBP1-92012)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HSPA1L |
![Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/HspA1L-Antibody-Western-Blot-NBP1-92012-img0008.jpg "Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HspA1L-Antibody-Immunohistochemistry-Paraffin-NBP1-92012-img0016.jpg "Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/HspA1L-Antibody-Western-Blot-NBP1-92012-img0006.jpg "Western Blot: HspA1L Antibody [NBP1-92012] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HspA1L-Antibody-Immunohistochemistry-Paraffin-NBP1-92012-img0013.jpg "Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/HspA1L-Antibody-Immunohistochemistry-Paraffin-NBP1-92012-img0014.jpg "Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HspA1L-Antibody-Immunohistochemistry-Paraffin-NBP1-92012-img0015.jpg "Immunohistochemistry-Paraffin: HspA1L Antibody [NBP1-92012] - Staining of human prostate shows no positivity in glandular cells as expected.")
![ELISA HSP70/HSPA1A [Biotin]](https://images.novusbio.com/images2/dyc1663-2_human-mouse-rat-total-hsp70-hspa1a-duoset-ic-elisa-5-plate-elisa-109202094930.jpg)
![ELISA HSP70/HSPA1A [Biotin]](https://images.novusbio.com/images2/dyc1663-2_human-mouse-rat-total-hsp70-hspa1a-duoset-ic-elisa-5-plate-elisa-512021144631.png)
![ELISA HSP70/HSPA1A [Biotin]](https://images.novusbio.com/images2/dyc1663-2_human-mouse-rat-total-hsp70-hspa1a-duoset-ic-elisa-5-plate-elisa-512021144743.png)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICAM1_AF796_Immunohistochemistry_17354.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-4120241048112.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-41202410481112.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")