![Western Blot: HLRC1 Antibody [NBP1-91994] - Analysis in control (vector only transfected HEK293T lysate) and DOHH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/HLRC1-Antibody-Western-Blot-NBP1-91994-img0006.jpg "Western Blot: HLRC1 Antibody [NBP1-91994] - Analysis in control (vector only transfected HEK293T lysate) and DOHH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DOHH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22678.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22679.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22682.jpg)
| Publication using NBP1-91994 | Applications | Species |
|---|---|---|
| Ofek P, Yeini E, Arad G et al. Deoxyhypusine hydroxylase: A novel therapeutic target differentially expressed in short-term vs long-term survivors of glioblastoma International journal of cancer 2023-05-04 [PMID: 37141410] (IHC, Mouse) | IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DOHH |
![Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/HLRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-91994-img0011.jpg "Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/HLRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-91994-img0007.jpg "Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/HLRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-91994-img0008.jpg "Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HLRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-91994-img0009.jpg "Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/HLRC1-Antibody-Immunohistochemistry-Paraffin-NBP1-91994-img0010.jpg "Immunohistochemistry-Paraffin: HLRC1 Antibody [NBP1-91994] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Western_Blot_12490.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Flow_Cytometry_12540.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/mab7616_human-integrin-alpha-2b-cd41-mab-clone-2530a-flow-cytometry-2462022151722.jpg)
![Immunocytochemistry FABP6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP6_AF3880_Immunocytochemistry__Immunofluorescence_20097.jpg)
![Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af196_mouse-desert-hedgehog-dhh-c-terminus-affinity-purified-pab-8220249511434.jpg)
![Immunohistochemistry Desert Hedgehog/Dhh Antibody [Unconjugated] - C-terminus](https://images.novusbio.com/images/af196_mouse-desert-hedgehog-dhh-c-terminus-affinity-purified-pab-44202415425011.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")