![Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/HIF-3-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-89977-img0004.jpg "Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HIF3A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HIF-3 alpha Antibody (NBP1-89977)Find related products by research area.
|
|
HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt... Read full blog post. |
|
HIF-3 alpha: a versatile target with hypoxia dependent and independent functions By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon... Read full blog post. |
|
HIF Prolyl Hydroxylase 2: an important Oxygen Sensor Protein Prolyl hydroxylase domain (PHD) proteins, including PHD1, PHD2, and PHD3, mediate oxygen-dependent degradation of hypoxia-inducible factor (HIF) alpha subunits. Suppression of PHD enzymes leads to stabilization of HIFs and offers a potential treatment... Read full blog post. |
|
HIF Antibodies: Beyond HIF-1 alpha The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the... Read full blog post. |
|
A Role for HIF-1 alpha Antibody in Renal Research The Hypoxia Inducible Factors (HIFs) are a family of mammalian transcription factors which are expressed in response to low cellular oxygen concentrations (hypoxia). Three human hypoxia inducible factors have been identified, HIF-1, HIF-2 and HIF-3, e... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human Fallopian tube shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/HIF-3-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-89977-img0001.jpg "Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human Fallopian tube shows moderate to strong nuclear and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human prostate shows moderate to strong cytoplasmic and nuclear positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/HIF-3-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-89977-img0002.jpg "Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human prostate shows moderate to strong cytoplasmic and nuclear positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/HIF-3-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-89977-img0003.jpg "Immunohistochemistry-Paraffin: HIF-3 alpha Antibody [NBP1-89977] - Staining of human placenta shows moderate to strong nuclear and cytoplasmic positivity in trophoblastic cells.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")