Novus Biologicals products are now on bio-techne.com

HGD Antibody

Name: HGD Antibody
Brand: Novus Biologicals
SKU: NBP2-49039
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Western Blot: HGD Antibody [NBP2-49039] - Analysis using Anti-HGD antibody NBP2-49039 (A) shows similar pattern to independent antibody NBP2-33488 (B).

Independent Antibodies: Western Blot: HGD Antibody [NBP2-49039] - Analysis using Anti-HGD antibody NBP2-49039 (A) shows similar pattern to independent antibody NBP2-33488 (B).

Immunocytochemistry/ Immunofluorescence: HGD Antibody [NBP2-49039] - Staining of human cell line RPTEC TERT1 shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human tonsil using Anti-HGD antibody NBP2-49039.

Western Blot: HGD Antibody [NBP2-49039] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human ...read more

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human tonsil shows low expression as expected.

Orthogonal Strategies: Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining in human liver and tonsil tissues using anti-HGD antibody. Corresponding HGD RNA-seq data are presented for the same ...read more

Independent Antibodies: Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human gallbladder, kidney, liver and tonsil using Anti-HGD antibody NBP2-49039 (A) shows similar protein distribution ...read more

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human kidney.

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human gallbladder.

Immunohistochemistry-Paraffin: HGD Antibody [NBP2-49039] - Staining of human liver using Anti-HGD antibody NBP2-49039.

Product Details

Summary

Reactivity	Hu, MuSpecies Glossary
Applications	WB, ICC/IF, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Validated by:

Independent Antibodies

Orthogonal Strategies

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HGD Antibody Summary

Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ
Predicted Species	Mouse (94%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	HGD
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions

Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Immunohistochemistry 1:200 - 1:500
Immunohistochemistry-Paraffin 1:200 - 1:500
Western Blot 0.04-0.4 ug/ml

Application Notes

For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Control Peptide

HGD Recombinant Protein Antigen (NBP2-49039PEP)

Reactivity Notes

Rat (89%)

Packaging, Storage & Formulations

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Alternate Names for HGD Antibody

AKU
EC 1.13.11.5
HGOFLJ94126
homogentisate 1,2-dioxygenase (homogentisate oxidase)
homogentisate 1,2-dioxygenase
homogentisate oxidase
Homogentisate oxygenase
Homogentisic acid oxidase
homogentisicase

Background

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Glucagon Antibody
(181402) [Unconjugate ...

MAB1249

Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]

(1 Review)

(14 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICC, ICFlow

AGA Antibody

NBP1-88866

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

ERMAP Antibody
[Unconjugated]

AF4928

Species: Hu

Applications: CyTOF-ready, Flow, WB

HPD Antibody

NBP1-89366

Immunohistochemistry-Paraffin HPD Antibody

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

DYX1C1 Antibody

NBP1-68766

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

PEX7 Antibody

NBP1-57578

(1 Publication)

Species: Hu

Applications: WB

PHYH Antibody

NBP1-87349

Immunohistochemistry-Paraffin PHYH Antibody

Species: Hu, Mu

Applications: IHC, IHC-P, WB

Fucosyltransferase
2/FUT2

7770-GT

(2 Publications)

Species: Hu

Applications: EnzAct

SQLE Antibody -
Azide and BSA Free

NBP2-93808

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Fumarylacetoacetate hy

NBP2-48736

Western Blot Fumarylacetoacetate hydrolase Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Nucleostemin
Antibody [Unconjugate

AF1638

Simple Western Nucleostemin Antibody [Unconjugated]

Western Blot Nucleostemin Antibody [Unconjugated]

(9 Publications)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

Somatostatin
Antibody (7G5) - BSA

NBP2-37447

Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free

ELISA Somatostatin Antibody (7G5) - BSA Free

(1 Review)

(3 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P

KRAS Antibody
(3B10-2F2)

H00003845-M01

(1 Review)

(17 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IP, WB

Fumarylacetoacetate hy

NBP2-48736

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

ErbB2/Her2
[Unconjugated]

1129-ER

(58 Publications)

Species: Hu

Applications: BA

Publications for HGD Antibody (NBP2-49039) (0)

There are no publications for HGD Antibody (NBP2-49039).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGD Antibody (NBP2-49039) (0)

There are no reviews for HGD Antibody (NBP2-49039). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for HGD Antibody (NBP2-49039) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional HGD Products

Research Areas for HGD Antibody (NBP2-49039)

Find related products by research area.

Blogs on HGD

There are no specific blogs for HGD, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Rabbit Anti-Human/Mouse/Rat HSP60 Polyclonal Antibody (AF1800) using a 1:1000 dilution of HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Rabbit IgG Secondary Antibody [HRP]
HAF008

Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP]
NB7160

Rabbit IgG Isotype Control
NBP2-24891

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our HGD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol

HGD

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HGD Antibody

Species Glossary

Images

Product Details

Order Details

HGD Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for HGD Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HGD Antibody (NBP2-49039) (0)

Reviews for HGD Antibody (NBP2-49039) (0)

Product General Protocols

Video Protocols

FAQs for HGD Antibody (NBP2-49039) (0)

Secondary Antibodies

Isotype Controls

Additional HGD Products

Research Areas for HGD Antibody (NBP2-49039)

Blogs on HGD

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics