Hepcidin Antimicrobial Peptide Antibody (1F9) Summary
Immunogen |
HAMP (AAH20612, 25 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT |
Specificity |
HAMP - hepcidin antimicrobial peptide |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
HAMP |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:100-1:2000
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:10-1:500
- Western Blot 1:500
|
Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Hepcidin Antimicrobial Peptide Antibody (1F9)
Background
The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Mu
Applications: ELISA
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Publications for Hepcidin Antimicrobial Peptide Antibody (H00057817-M02) (0)
There are no publications for Hepcidin Antimicrobial Peptide Antibody (H00057817-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hepcidin Antimicrobial Peptide Antibody (H00057817-M02) (0)
There are no reviews for Hepcidin Antimicrobial Peptide Antibody (H00057817-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hepcidin Antimicrobial Peptide Antibody (H00057817-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hepcidin Antimicrobial Peptide Products
Blogs on Hepcidin Antimicrobial Peptide