GPR39 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: HANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQSKSQSLSLESLEPNSGAKPANSA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GPR39 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for GPR39 Antibody
Background
GPR39 is an Orphan-A GPCR with an unknown ligand. GPR39 is related to the growth hormone secretagogue receptor, which is a receptor for ghrelin. At least three mRNA variants of GPR39 have been reported. GPR39 expression has been documented in human brain and peripheral tissues (McKee et al., 1997). ESTs have been isolated from human tissue libraries, including normal eye, brain, heart/melanocyte/uterus and vessel, and cancerous brain, germ cell, kidney and ovary.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: IHC
Publications for GPR39 Antibody (NBP1-87551) (0)
There are no publications for GPR39 Antibody (NBP1-87551).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR39 Antibody (NBP1-87551) (0)
There are no reviews for GPR39 Antibody (NBP1-87551).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for GPR39 Antibody (NBP1-87551) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GPR39 Products
Research Areas for GPR39 Antibody (NBP1-87551)
Find related products by research area.
|
Blogs on GPR39