Independent Antibodies: Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-GOLGA2 antibody NBP1-89756 (A) shows similar ...read more
Independent Antibodies: Western Blot: GM130/GOLGA2 Antibody [NBP1-89756] - Analysis using Anti-GOLGA2 antibody NBP1-89756 (A) shows similar pattern to independent antibody NBP1-89758 (B).
Immunocytochemistry/ Immunofluorescence: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human lymph node using Anti-GOLGA2 antibody NBP1-89756.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human testis.
Immunohistochemistry-Paraffin: GM130/GOLGA2 Antibody [NBP1-89756] - Staining of human colon.
This antibody was developed against Recombinant Protein corresponding to amino acids: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
Marker
Golgi Apparatus Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GOLGA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for GM130/GOLGA2 Antibody
130 kDa cis-Golgi matrix protein
GM130 autoantigen
GM130
GM130Golgi matrix protein GM130
GOLGA2
golgi autoantigen, golgin subfamily a, 2
golgin A2
Golgin subfamily A member 2
Golgin-95
MGC20672
SY11 Protein
Background
Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GM130/GOLGA2 Antibody and receive a gift card or discount.