Glutathione Peroxidase 4/GPX4 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVAS |
Predicted Species |
Mouse (98%), Rat (93%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GPX4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Glutathione Peroxidase 4/GPX4 Antibody
Background
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Rt
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Publications for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139) (0)
There are no publications for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139) (0)
There are no reviews for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Glutathione Peroxidase 4/GPX4 Products
Research Areas for Glutathione Peroxidase 4/GPX4 Antibody (NBP2-56139)
Find related products by research area.
|
Blogs on Glutathione Peroxidase 4/GPX4