| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 224-287 of Human GLUT9 Source: Wheat Germ (in vitro) Amino Acid Sequence: PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | SLC2A9 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 32.78 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for GLUT9 Partial Recombinant Protein (H00056606-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC2A9 |
![Flow Cytometry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Flow_Cytometry_19979.jpg)
![Immunocytochemistry Glut3 Antibody (202017) [Unconjugated]](https://images.novusbio.com/images2/Glut3_MAB1415_Immunocytochemistry__Immunofluorescence_20431.jpg)
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry: GLUT9 Antibody [NBP1-05054] - Immunofluorescence staining of GLUT9 in PFA-fixed murine brain sections. Frozen sections of paraformaldehyde-fixed wild-type murine brain were used for immunofluorescence staining. a, b Antigen absorption test. Immunofluorescence staining of the ependymal wall of the dorsal third ventricle using a anti-GLUT9 antibody and b antigen-preabsorbed antibody. Scale bar 100 um. c, d Immunofluorescence staining of GLUT9 (magenta), acetylated-tubulin (Ac-Tubulin, green) and DAPI (blue) on ependymal cells. Scale bar 10 um. e-g Immunofluorescence staining of GLUT9 (magenta) and NeuN (green) showing co-localization in neurons. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (https://fluidsbarrierscns.biomedcentral.com/articles/10.1186/s12987-016-0046-x) licensed under a CC-BY license.](https://images.novusbio.com/images/GLUT9-Antibody-Immunohistochemistry-NBP1-05054-img0006.jpg "Immunohistochemistry: GLUT9 Antibody [NBP1-05054] - Immunofluorescence staining of GLUT9 in PFA-fixed murine brain sections. Frozen sections of paraformaldehyde-fixed wild-type murine brain were used for immunofluorescence staining. a, b Antigen absorption test. Immunofluorescence staining of the ependymal wall of the dorsal third ventricle using a anti-GLUT9 antibody and b antigen-preabsorbed antibody. Scale bar 100 um. c, d Immunofluorescence staining of GLUT9 (magenta), acetylated-tubulin (Ac-Tubulin, green) and DAPI (blue) on ependymal cells. Scale bar 10 um. e-g Immunofluorescence staining of GLUT9 (magenta) and NeuN (green) showing co-localization in neurons. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (https://fluidsbarrierscns.biomedcentral.com/articles/10.1186/s12987-016-0046-x) licensed under a CC-BY license.")