![Immunohistochemistry-Paraffin: Glucuronic Acid Epimerase Antibody [NBP2-31872] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.](http://images.novusbio.com/fullsize/Glucuronic-Acid-Epimerase-Antibody-Immunohistochemistry-Paraffin-NBP2-31872-img0003.jpg "Immunohistochemistry-Paraffin: Glucuronic Acid Epimerase Antibody [NBP2-31872] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | Flow, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ETSEGVSLQLGNTKDFIISFDLKFLTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRKGVGLSNTKAVKPTKIMPKKVVRLI |
| Predicted Species | Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLCE |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Flow and Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:31972438). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Simple_Western_18969.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF1060_Western_Blot_19006.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images/af1060_mouse-decorin-affinity-purified-polyclonal-ab-8120255552891.jpg)
| Publication using NBP2-31872 | Applications | Species |
|---|---|---|
| Listik E, Xavier EG, Silva Pinhal MAD, Toma L Dermatan sulfate epimerase 1 expression and mislocalization may interfere with dermatan sulfate synthesis and breast cancer cell growth Carbohydr. Res. 2020-01-07 [PMID: 31972438] (FLOW, ICC/IF, Human) | FLOW, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Western_Blot_11618.jpg)
![Immunohistochemistry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Immunohistochemistry_11640.jpg)
![Flow Cytometry Syndecan-2/CD362 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syndecan-2_AF6585_Flow_Cytometry_11674.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![N/A APRIL/TNFSF13 [Biotin]](https://images.novusbio.com/images2/DATA_APRIL_DY884_ELISA_2333.jpg)
![N/A APRIL/TNFSF13 [Biotin]](https://images.novusbio.com/images2/DATA_APRIL_DY884_ELISA_2253.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")