![Western Blot: GIF Antibody [NBP1-81611] - Analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/GIF-Antibody-Western-Blot-NBP1-81611-img0007.jpg "Western Blot: GIF Antibody [NBP1-81611] - Analysis in control (vector only transfected HEK293T lysate) and GIF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBLIF |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![PGA5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PGA5 [Unconjugated]")
| Publication using NBP1-81611 | Applications | Species |
|---|---|---|
| Wang Z, Wang Q, Chen C et al. NNMT enriches for AQP5+ cancer stem cells to drive malignant progression in early gastric cardia adenocarcinoma Gut 2023-03-28 [PMID: 36977555] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CBLIF |
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0011.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0004.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human stomach shows high expression.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0005.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human stomach shows high expression.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining in human stomach and liver tissues using anti-GIF antibody. Corresponding GIF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0006.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining in human stomach and liver tissues using anti-GIF antibody. Corresponding GIF RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Analysis in human stomach and skeletal muscle tissues using NBP1-81611 antibody. Corresponding GIF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0008.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Analysis in human stomach and skeletal muscle tissues using NBP1-81611 antibody. Corresponding GIF RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0009.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human small intestine shows no cytoplasmic positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0010.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human small intestine shows no cytoplasmic positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/GIF-Antibody-Immunohistochemistry-Paraffin-NBP1-81611-img0012.jpg "Immunohistochemistry-Paraffin: GIF Antibody [NBP1-81611] - Staining of human tonsil shows no cytoplasmic positivity in germinal center cells as expected.")
![Immunohistochemistry Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Immunohistochemistry_24138.jpg)
![Western Blot Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Western_Blot_20441.jpg)
![Simple Western Cubilin Antibody [Unconjugated]](https://images.novusbio.com/images2/Cubilin_AF3700_Simple_Western_20573.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")