Home » Ghrelin Receptor/GHSR » Ghrelin Receptor Peptides and Proteins » Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-289 of Human GHSR

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
GHSR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
58.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein

  • GH-releasing peptide receptor
  • Ghrelin receptor
  • GHRP
  • GHSR
  • GHS-R
  • growth hormone secretagogue receptor type 1
  • growth hormone secretagogue receptor

Background

This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ghrelin Antibody
(883622)
MAB8200
Immunohistochemistry Ghrelin Antibody (883622)
Immunohistochemistry Ghrelin Antibody (883622)
(11 Publications)
Species: Hu, Mu
Applications: IHC
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
GHRH Antibody -
Azide and BSA Free
NBP3-04850
Western Blot GHRH Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Ghrelin Antibody
(883622)
MAB8200
Immunohistochemistry Ghrelin Antibody (883622)
Immunohistochemistry Ghrelin Antibody (883622)
(11 Publications)
Species: Hu, Mu
Applications: IHC
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(810 Publications)
Species: Hu
Applications: BA
Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot Corticotropin Releasing Factor Antibody (2B11)
Sandwich ELISA Corticotropin Releasing Factor Antibody (2B11)
(4 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
GHRHR Antibody -
BSA Free
NLS836
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Recombinant Human
Ghrelin Receptor/GHSR ...
H00002693-P01
Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01) (0)

There are no publications for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01) (0)

There are no reviews for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ghrelin Receptor/GHSR Products

Research Areas for Ghrelin Receptor/GHSR Recombinant Protein (H00002693-P01)

Find related products by research area.

Blogs on Ghrelin Receptor/GHSR

There are no specific blogs for Ghrelin Receptor/GHSR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ghrelin Receptor/GHSR GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol GHSR