![Western Blot: GALM Antibody [NBP2-38252] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue](http://images.novusbio.com/fullsize/GALM-Antibody-Western-Blot-NBP2-38252-img0003.jpg "Western Blot: GALM Antibody [NBP2-38252] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GALM |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GALM Antibody (NBP2-38252)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: GALM Antibody [NBP2-38252] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38252-img0004.jpg "Immunocytochemistry/Immunofluorescence: GALM Antibody [NBP2-38252] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0009.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human cerebral cortex.")
![Immunohistochemistry: GALM Antibody [NBP2-38252] - Staining of human fallopian tube shows moderate cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-NBP2-38252-img0002.jpg "Immunohistochemistry: GALM Antibody [NBP2-38252] - Staining of human fallopian tube shows moderate cytoplasmic and nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0005.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0006.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human skin shows low expression as expected.")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining in human kidney and skin tissues using anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0007.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining in human kidney and skin tissues using anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland, cerebral cortex, kidney and skin using Anti-GALM antibody NBP2-38252 (A) shows similar protein distribution across tissues to independent antibody NBP1-85906 (B).](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0008.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland, cerebral cortex, kidney and skin using Anti-GALM antibody NBP2-38252 (A) shows similar protein distribution across tissues to independent antibody NBP1-85906 (B).")
![Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland.](http://images.novusbio.com/fullsize/GALM-Antibody-Immunohistochemistry-Paraffin-NBP2-38252-img0010.jpg "Immunohistochemistry-Paraffin: GALM Antibody [NBP2-38252] - Staining of human adrenal gland.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")