![Western Blot: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of extracts of various cell lines, using Galactosylceramidase/GALC antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.](http://images.novusbio.com/fullsize/Galactosylceramidase-GALC-Antibody-Western-Blot-NBP3-03718-img0004.jpg "Western Blot: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of extracts of various cell lines, using Galactosylceramidase/GALC antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human Galactosylceramidase/GALC (NP_000144.2). GGAYVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIVGAKRYHDLDIDYIGIWNERSYNANYIKILRKMLNYQGLQRVKIIASDNLWESISASMLLDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYINGY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GALC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 77 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Galactosylceramidase/GALC Antibody (NBP3-03718)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GALC |
![Immunocytochemistry/Immunofluorescence: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of HeLa cells using GALC Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Galactosylceramidase-GALC-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03718-img0006.jpg "Immunocytochemistry/Immunofluorescence: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of HeLa cells using GALC Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of A-549 cells using GALC Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Galactosylceramidase-GALC-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03718-img0005.jpg "Immunocytochemistry/Immunofluorescence: Galactosylceramidase/GALC Antibody [NBP3-03718] - Analysis of A-549 cells using GALC Rabbit pAb at dilution of 1:250 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Galactosylceramidase/GALC Antibody [NBP3-03718] -Human kidney using GALC Rabbit pAb at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/antibody/nbp3-03718_rabbit-polyclonal-galactosylceramidase-galc-antibody-immunohistochemistry-paraffin-682024111037..jpg "Immunohistochemistry-Paraffin: Galactosylceramidase/GALC Antibody [NBP3-03718] -Human kidney using GALC Rabbit pAb at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: Galactosylceramidase/GALC Antibody - BSA Free [Galactosylceramidase/GALC] - Immunofluorescence analysis of A-549 cells using Galactosylceramidase/GALC Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-03718_rabbit-polyclonal-galactosylceramidase-galc-antibody-5220251638083.jpg "Immunocytochemistry/ Immunofluorescence: Galactosylceramidase/GALC Antibody - BSA Free [Galactosylceramidase/GALC] - Immunofluorescence analysis of A-549 cells using Galactosylceramidase/GALC Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Simple Western Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/16239.jpg)
![Western Blot Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Western_Blot_12708.jpg)
![Immunocytochemistry Glucosylceramidase/GBA Antibody (812201) [Unconjugated]](https://images.novusbio.com/images2/Glucosylceramidase_MAB7410_Immunocytochemistry_12732.jpg)
![Immunocytochemistry PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Immunocytochemistry_16563.jpg)
![Western Blot PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/PSAP_AF8520_Western_Blot_16593.jpg)
![Simple Western PSAP Antibody [Unconjugated]](https://images.novusbio.com/images2/af8520_human-psap-affinity-purified-polyclonal-ab-simple-western-13420221645.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")