![Western Blot: FXR1 Antibody [NBP1-89546] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/FXR1-Antibody-Western-Blot-NBP1-89546-img0010.jpg "Western Blot: FXR1 Antibody [NBP1-89546] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FXR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89546 | Applications | Species |
|---|---|---|
| Fischer-Keso R, Breuninger S, Hofmann S et al. Plakophilins 1 and 3 Bind to FXR1 and Thereby Influence the mRNA Stability of Desmosomal Proteins. Mol Cell Biol 2014-12-01 [PMID: 25225333] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for FXR1 Antibody (NBP1-89546)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FXR1 |
![Immunocytochemistry/Immunofluorescence: FXR1 Antibody [NBP1-89546] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FXR1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89546-img0011.jpg "Immunocytochemistry/Immunofluorescence: FXR1 Antibody [NBP1-89546] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/FXR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89546-img0015.jpg "Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: FXR1 Antibody [NBP1-89546] - Analysis in human cell line U-251 MG.](http://images.novusbio.com/fullsize/FXR1-Antibody-Western-Blot-NBP1-89546-img0009.jpg "Western Blot: FXR1 Antibody [NBP1-89546] - Analysis in human cell line U-251 MG.")
![Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/FXR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89546-img0012.jpg "Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/FXR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89546-img0013.jpg "Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/FXR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89546-img0014.jpg "Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.")
![Simple Western: FXR1 Antibody [NBP1-89546] - Simple Western lane view shows a specific band for FXR1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/FXR1-Antibody-Simple-Western-NBP1-89546-img0006.jpg "Simple Western: FXR1 Antibody [NBP1-89546] - Simple Western lane view shows a specific band for FXR1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: FXR1 Antibody [NBP1-89546] - Electropherogram image(s) of corresponding Simple Western lane view. FXR1 antibody was used at 1:100 dilution on RT-4 and U-251MG sp lysates(s).](http://images.novusbio.com/fullsize/FXR1-Antibody-Simple-Western-NBP1-89546-img0007.jpg "Simple Western: FXR1 Antibody [NBP1-89546] - Electropherogram image(s) of corresponding Simple Western lane view. FXR1 antibody was used at 1:100 dilution on RT-4 and U-251MG sp lysates(s).")
![FXR/NR1H4 Antibody (A9033A) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FXR/NR1H4 Antibody (A9033A) [Unconjugated]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")