Frizzled-7 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FZD7 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Frizzled-7 Antibody
Background
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD7 protein contains an N-terminal signal sequence, 10 cysteine residues typical of the cysteine-rich extracellular domain of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail with a PDZ domain-binding motif. FZD7 gene expression may downregulate APC function and enhance beta-catenin-mediated signals in poorly differentiated human esophageal carcinomas. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: BA
Species: Mu
Applications: IHC
Species: Hu, Mu, Pm
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC
Publications for Frizzled-7 Antibody (NBP2-55952) (0)
There are no publications for Frizzled-7 Antibody (NBP2-55952).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Frizzled-7 Antibody (NBP2-55952) (0)
There are no reviews for Frizzled-7 Antibody (NBP2-55952).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Frizzled-7 Antibody (NBP2-55952) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Frizzled-7 Products
Research Areas for Frizzled-7 Antibody (NBP2-55952)
Find related products by research area.
|
Blogs on Frizzled-7