FRAS1 (Fraser syndrome 1) Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: IWIQLNYLPSYGTLLRISGSEVEELSEVSNFTMEDINNKKIRYSAVFETDGHLVTDSFYFSVSDMDHNHLDNQIFTIMITPAENPPPVIAFADLITVDEGGRAPLSFHHFFATDDDDNLQRDAIIKLSALPKYGCIENTGTGDRFG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FRAS1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for FRAS1 (Fraser syndrome 1) Antibody
Background
Found in a linear fashion underlying the epidermis and the basal surface of other epithelia in embryos. Highly expressed in the apical ectodermal ridge of the limb buds from E10.5-E12.5 and expression was also detected in the interdigital spaces at E14.5. Found in cells just underlying the surface epithelium of the entire embryo and in the linings of the peritoneal cavity and dorsal aorta. At E12 detected in the mesonephric duct and in the lens.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Hu
Applications: Bind, BA
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western
Species: Hu
Applications: IHC
Publications for FRAS1 (Fraser syndrome 1) Antibody (NBP2-38656) (0)
There are no publications for FRAS1 (Fraser syndrome 1) Antibody (NBP2-38656).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FRAS1 (Fraser syndrome 1) Antibody (NBP2-38656) (0)
There are no reviews for FRAS1 (Fraser syndrome 1) Antibody (NBP2-38656).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FRAS1 (Fraser syndrome 1) Antibody (NBP2-38656) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FRAS1 (Fraser syndrome 1) Products
Blogs on FRAS1 (Fraser syndrome 1)