![Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/FKBP9-Antibody-Western-Blot-NBP1-83887-img0005.jpg "Western Blot: FKBP9 Antibody [NBP1-83887] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGMDQALVGMCVNERRFVKIPPKLAYGNEGVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDF |
| Predicted Species | Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FKBP9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83887 | Applications | Species |
|---|---|---|
| Oh S, Yeom J, Cho HJ et al. Integrated pharmaco-proteogenomics defines two subgroups in isocitrate dehydrogenase wild-type glioblastoma with prognostic and therapeutic opportunities Nat Commun 2020-07-03 [PMID: 32620753] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FKBP9 |
![Immunocytochemistry/Immunofluorescence: FKBP9 Antibody [NBP1-83887] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83887-img0006.jpg "Immunocytochemistry/Immunofluorescence: FKBP9 Antibody [NBP1-83887] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunohistochemistry-Paraffin-NBP1-83887-img0010.jpg "Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunohistochemistry-Paraffin-NBP1-83887-img0002.jpg "Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunohistochemistry-Paraffin-NBP1-83887-img0007.jpg "Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunohistochemistry-Paraffin-NBP1-83887-img0008.jpg "Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human gastrointestinal shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human placenta shows strong granular cytoplasmic positivity in in trophoblastic cells.](http://images.novusbio.com/fullsize/FKBP9-Antibody-Immunohistochemistry-Paraffin-NBP1-83887-img0009.jpg "Immunohistochemistry-Paraffin: FKBP9 Antibody [NBP1-83887] - Staining of human placenta shows strong granular cytoplasmic positivity in in trophoblastic cells.")
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")