FFAR4/GPR120 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 333-377 of human FFAR4/GPR120 (NP_859529.2). NPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FFAR4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 50% glycerol, pH7.3 |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for FFAR4/GPR120 Antibody - Azide and BSA Free
Background
GPR120 is an Orphan-A GPCR with no known ligand. An EST has been isolated from a human colon cancer library.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Pm
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu
Applications: Func, QFN
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Eq, Hu, Pm
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for FFAR4/GPR120 Antibody (NBP3-15594) (0)
There are no publications for FFAR4/GPR120 Antibody (NBP3-15594).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FFAR4/GPR120 Antibody (NBP3-15594) (0)
There are no reviews for FFAR4/GPR120 Antibody (NBP3-15594).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FFAR4/GPR120 Antibody (NBP3-15594) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FFAR4/GPR120 Products
Research Areas for FFAR4/GPR120 Antibody (NBP3-15594)
Find related products by research area.
|
Blogs on FFAR4/GPR120