Ferritin Heavy Chain Antibody (1Q10I7) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ferritin Heavy Chain (P02794). MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNA |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
FTH1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Ferritin Heavy Chain Antibody (1Q10I7)
Background
Stores iron in a soluble. nontoxic. readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Ferritin is a ubiquitous and highly conserved protein which plays a major role in iron homeostasis by sequestering and storing iron in a non-toxic and soluble form. It forms a holoenzyme of ~450 kDa, consisting of 24 subunits of two types, H (heavy; 21 kDa) and L (light; 19 kDa), and is capable of storing up to 4,500 atoms of ferric iron. Depending on the tissue type and physiological status of the cell, the ratio of H to L subunits in ferritin can vary widely. Ferritin is found in the liver, spleen, kidney and heart, with smaller amounts being found in blood. Serum ferritin levels serve as an indicator of the amount of iron stored in the body. Serum ferritin is the most sensitive test for anaemia, and is also used as a marker for restless leg syndrome, hemochromatosis and porphyria. As ferritin is an acute-phase reactant, it is often elevated during infection. Defects in ferritin proteins are associated with several neurodegenerative diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for Ferritin Heavy Chain Antibody (NBP3-15766) (0)
There are no publications for Ferritin Heavy Chain Antibody (NBP3-15766).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Ferritin Heavy Chain Antibody (NBP3-15766) (0)
There are no reviews for Ferritin Heavy Chain Antibody (NBP3-15766).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Ferritin Heavy Chain Antibody (NBP3-15766) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Ferritin Heavy Chain Products
Research Areas for Ferritin Heavy Chain Antibody (NBP3-15766)
Find related products by research area.
|
Blogs on Ferritin Heavy Chain