![Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Western-Blot-NBP1-89560-img0008.jpg "Western Blot: FDFT1 Antibody [NBP1-89560] - Analysis in human cell line HEK 293.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FDFT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for FDFT1 Antibody (NBP1-89560)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FDFT1 |
![Immunocytochemistry/Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89560-img0010.jpg "Immunocytochemistry/Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89560-img0014.jpg "Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human duodenum shows weak to moderate cytoplasmic/ membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89560-img0011.jpg "Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human duodenum shows weak to moderate cytoplasmic/ membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89560-img0012.jpg "Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/FDFT1-Antibody-Immunohistochemistry-Paraffin-NBP1-89560-img0013.jpg "Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Immunohistochemistry_19187.jpg)
![Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]](https://images.novusbio.com/images2/Glycophorin_A_MAB1228_Flow_Cytometry_19288.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Western_Blot_5750.jpg)
![Simple Western SGPL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SGPL1_AF5535_Simple_Western_17128.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")