FCGR2C Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 43-223 of human FCGR2C (NP_963857.3). TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FCGR2C |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:1000-1:4000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS with 50% glycerol, pH7.3. |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for FCGR2C Antibody - BSA Free
Background
The FCGR2C gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing o
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Block, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Publications for FCGR2C Antibody (NBP3-05032) (0)
There are no publications for FCGR2C Antibody (NBP3-05032).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FCGR2C Antibody (NBP3-05032) (0)
There are no reviews for FCGR2C Antibody (NBP3-05032).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FCGR2C Antibody (NBP3-05032) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FCGR2C Products
Research Areas for FCGR2C Antibody (NBP3-05032)
Find related products by research area.
|
Blogs on FCGR2C